COBLL1 anticorps (Middle Region)

N° du produit ABIN632504

L’anticorps Lapin Polyclonal anti-COBLL1 a été validé pour WB. Il convient pour détecter COBLL1 dans des échantillons de Humain.

Aperçu rapide pour COBLL1 anticorps (Middle Region) (ABIN632504)

Antigène: COBLL1 (COBL-Like 1 (COBLL1))

Reactivité: Humain

Hôte: Lapin

Clonalité: Polyclonal

Conjugué: Cet anticorp COBLL1 est non-conjugé

Application: Western Blotting (WB)

Détail du produit anti-COBLL1 anticorps

Épitope: Middle Region

Specificité: Cobl-Like 1 antibody was raised against the middle region of COBLL1

Purification: Affinity purified

Immunogène: Cobl-Like 1 antibody was raised using the middle region of COBLL1 corresponding to a region with amino acids QAKPSSFFLQMQKRVSGHYVTSAAAKSVHAAPNPAPKELTNKEAERDMLP

Information d'application

Indications d'application: WB: 1 µg/mL
Optimal conditions should be determined by the investigator.

Commentaires:

Cobl-Like 1 Blocking Peptide, (ABIN5612945), is also available for use as a blocking control in assays to test for specificity of this Cobl-Like 1 antibody

Restrictions: For Research Use only

Stockage

Format: Lyophilized

Reconstitution: Lyophilized powder. Add distilled water for a 1 mg/mL concentration of COBLL1 antibody in PBS

Concentration: Lot specific

Buffer: PBS

Conseil sur la manipulation: Avoid repeated freeze/thaw cycles.
Dilute only prior to immediate use.

Stock: 4 °C/-20 °C

Stockage commentaire: Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.

Détails sur COBLL1

Antigène: COBLL1 (COBL-Like 1 (COBLL1))

Autre désignation: Cobl-Like 1

Sujet: The function of COBLL1 has not been widely studied, and is yet to be fully elucidated.

Poids moléculaire: 128 kDa (MW of target protein)